PNC 27

Compound Overview

Research Use Only. Not for Human Consumption.

PNC 27 is supplied by Nexus as a lyophilized research peptide in the Longevity & Cellular Health category. The supplied research record classifies PNC 27 as a p53-derived chimeric research peptide and describes the compound as a p53 HDM-2-binding segment fused to a membrane-residency / cell-penetrating peptide domain.

The available chemistry record is sequence-defined. For this Nexus listing, the source data identifies the amino-acid sequence as PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG, with a computed molecular weight of 4031.8 g/mol and computed molecular formula of C₁₈₈H₂₉₃N₅₃O₄₄S. Because the record also warns that public supplier references disagree on CAS values and exact mass, the sequence is treated as the primary chemistry anchor until lot-specific analytical documentation is available.

• Product: PNC 27
• Available Research Sizes: 5mg and 10mg
• SKUs: PN5 and PN10
• Catalog Category: Longevity & Cellular Health
• Classification: p53-derived chimeric research peptide
• Structural Description: p53 HDM-2-binding segment fused to a membrane-residency / cell-penetrating peptide domain
• Physical Form: Lyophilized powder
• Use: For in-vitro research use only. Not for human consumption.

Research Background & Published Literature

The provided research summary identifies PNC 27 as a sequence-defined chimeric peptide used in oncology-relevant cell-culture mechanism research. That description supports a controlled in-vitro positioning, but it does not provide disease-treatment claims, dosing guidance, clinical-use claims, animal-use guidance, or validated protocol recommendations. This page therefore limits the research background to the compound identity fields and source notes supplied in the product record.

The research file also notes that public supplier pages disagree on CAS and exact mass. Because of that conflict, this page does not publish a CAS number and does not treat a vendor CAS listing as authoritative. The amino-acid sequence supplied in the research data is the stronger identifier for this entry until a current lot has been reconciled against mass-spectrometry documentation.

The supplied source data lists the following reference sources:

No specific peer-reviewed citations were included in the provided research data. These listed sources are included because they appear in the supplied record; they should not be interpreted as lot-specific COA documentation, proof of purity, or confirmation of any therapeutic, diagnostic, veterinary, or human-use application.

Researchers reviewing the literature around this compound can use the peer-reviewed resources below for additional context on mechanism of action, signaling pathways, and controlled laboratory research applications:

• Sarafraz-Yazdi et al. (2022) — Biomedicines
• Thadi et al. (2020) — Anticancer Res
• Davitt et al. (2014) — Ann Clin Lab Sci

Storage, Handling & Stability Guidelines

The supplied storage guidance is to store lyophilized PNC 27 at -20°C, desiccated, and protected from light. After reconstitution, the research record advises aliquoting the material and avoiding repeated freeze-thaw cycles. These points are the only storage and stability instructions included in the provided data.

• Store sealed lyophilized material at -20°C.
• Maintain desiccated storage conditions to limit moisture exposure.
• Protect the vial from light during storage and handling.
• After reconstitution, aliquot according to validated laboratory SOPs.
• Avoid repeated freeze-thaw cycles after reconstitution.
• Maintain traceability between the vial label, SKU, receiving record, and any current analytical documentation.

The supplied source data does not provide a validated reconstitution solvent, target working concentration, post-reconstitution expiration interval, stability-study result, packaging validation, or temperature-excursion tolerance. Those values should not be inferred from adjacent peptide listings or informal protocol summaries.

Lab Verification

Nexus maintains research-compound verification information through the Lab Verified archive. For PNC 27, the supplied source data does not include exact COA values, batch numbers, purity percentages, HPLC retention-time values, chromatogram data, or mass-spectrum values, so this description does not present a lot-specific COA panel.

In general terms, peptide identity and quality review may include HPLC purity assessment and Mass Spectrometry identity confirmation where current lot documentation is available. For PNC 27 specifically, HPLC/MS review is important because the source record states that public references disagree on CAS and exact mass, and because the sequence is the strongest available identifier in the provided dataset.

Before initiating an in-vitro workflow, review the current product documentation available through /lab-verified and reconcile the product name, SKU, sequence, computed mass, and received vial label against internal inventory records.