PNC 27

Compound Overview

Research Use Only. Not for Human Consumption.

PNC 27 is supplied by Nexus as a lyophilized research peptide in the Longevity & Cellular Health category. The supplied research record classifies PNC 27 as a p53-derived chimeric research peptide and describes the compound as a p53 HDM-2-binding segment fused to a membrane-residency / cell-penetrating peptide domain.

The available chemistry record is sequence-defined. For this Nexus listing, the source data identifies the amino-acid sequence as PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG, with a computed molecular weight of 4031.8 g/mol and computed molecular formula of C₁₈₈H₂₉₃N₅₃O₄₄S. Because the record also warns that public supplier references disagree on CAS values and exact mass, the sequence is treated as the primary chemistry anchor until lot-specific analytical documentation is available.

• Product: PNC 27
• Available Research Sizes: 5mg and 10mg
• SKUs: PN5 and PN10
• Catalog Category: Longevity & Cellular Health
• Classification: p53-derived chimeric research peptide
• Structural Description: p53 HDM-2-binding segment fused to a membrane-residency / cell-penetrating peptide domain
• Physical Form: Lyophilized powder
• Use: For in-vitro research use only. Not for human consumption.

Research Background & Published Literature

The provided research summary identifies PNC 27 as a sequence-defined chimeric peptide used in oncology-relevant cell-culture mechanism research. That description supports a controlled in-vitro positioning, but it does not provide disease-treatment claims, dosing guidance, clinical-use claims, animal-use guidance, or validated protocol recommendations. This page therefore limits the research background to the compound identity fields and source notes supplied in the product record.

The supplied source data lists the following reference sources:

No specific peer-reviewed citations were included in the provided research data. These listed sources are included because they appear in the supplied record; they should not be interpreted as lot-specific COA documentation, proof of purity, or confirmation of any therapeutic, diagnostic, veterinary, or human-use application.

Researchers reviewing the literature around this compound can use the peer-reviewed resources below for additional context on mechanism of action, signaling pathways, and controlled laboratory research applications:

• Sarafraz-Yazdi et al. (2022) — Biomedicines
• Thadi et al. (2020) — Anticancer Res
• Davitt et al. (2014) — Ann Clin Lab Sci

Storage, Handling & Stability Guidelines

Use the applicable lot/source record for storage of unopened material. Any diluent selection, preparation, temperature, aliquoting, or post-reconstitution hold conditions must be established by a qualified laboratory under a validated SOP; this page does not establish a stability window.

• Store sealed lyophilized material at -20°C.
• Maintain desiccated storage conditions to limit moisture exposure.
• Protect the vial from light during storage and handling.
• Use a validated laboratory SOP and the applicable lot/source record for any preparation or post-reconstitution handling.
• Use a validated laboratory SOP and the applicable lot/source record for any preparation or post-reconstitution handling.
• Maintain traceability between the vial label, SKU, receiving record, and any current analytical documentation.

The supplied source data does not provide a validated reconstitution solvent, target working concentration, post-reconstitution expiration interval, stability-study result, packaging validation, or temperature-excursion tolerance. Those values should not be inferred from adjacent peptide listings or informal protocol summaries.

Quality Assurance & Lab Verification

The Certificate of Analysis for this catalog item is pending. No provisional batch, assay, method, analyst, or release data is published in this product dossier. Check the Lab Verified archive for documentation status.